Sporomusa sp. An4
Average proteome isoelectric point is 6.66
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,251 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0U1L4R7|A0A0U1L4R7_9FIRM Alkaline phosphatase
MAVINGTNDTDLLFGSTEDDEIYGLDGDDYLSGGDGNDSLYGGNGNDSLYGGAGDDYLDGGAGSDILVGGAGNNFLYGNDGDDYLIGDAGKDTLVGGDGNDYLYGYDDDDSLDGGLGSDYLLGGDGNDNLNGGAGNDTLLGGNGDDLLAGDQGDDLVAGDDYLDGGAGNDILLGEAGNDVLYGNDGNDYL
DGGTGNDTLLGGAGGDFLYGNDGDDSLDGGADNDTLYGSFGTDTLSGGSGDDLLYGDDGNDLLDGGSGNDTLYGGTGNDMLTGGADADTYTFQEDFGNDIIGAATDNSEDRIDLSAFSSSDASVSIGGTGGDDLIITIGTNTVTVADWSQSDGNKLNSFTFSDGTKTTNGTSWL
Molecular weight: 36.41 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0U1L0F4|A0A0U1L0F4_9FIRM Uncharacterized protein
MIAAFHFPAAQFAAPLLPAGPSHGTRRRGLFAVAGALFSWFGVKNPSIPGR
Molecular weight: 5.36 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,190 |
61 |
5,251 |
1,462,296 |
37 |
4,915 |
281.8 |
31.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.86 |
1.26 |
4.97 |
6.17 |
3.86 |
7.31 |
1.8 |
7.52 |
5.99 |
9.79 |
2.71 |
4.34 |
3.98 |
3.84 |
4.5 |
5.7 |
5.69 |
7.23 |
1.02 |
3.46 |
Note: For statistics only major isoforms were used (in this case 5,190 proteins)
For dipeptide frequency statistics click
here