Parcubacteria group bacterium GW2011_GWC2_32_10
Average proteome isoelectric point is 7.24
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,108 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0F9YN74|A0A0F9YN74_9BACT Uncharacterized protein (Fragment)
SLVSVGSESTSSLTSENDTTGADSTNTSSNTVTNDITVEDSNSANIDNSQELLAETGENSSSNNTGSGQVVTGEASSEANFSNGSLSLNSNTTVIDMGSGEVSSTSSNNTTGADSTNTSSTSLANTADITNSNDAEIENSAEVHTTSGDNDSNNNTGDGSIETGDVSGTANIMNDLNVNETTVGMASMMT
LSSSNETTGSDSTNTSTATVSNSLSVSNTNNSSLVNTSTISVNSGDNTSSNNTGSGSTTTGNGAVMFEIVNQSNVNTTEIGS
Molecular weight: 27.12 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0B2J4|A0A0G0B2J4_9BACT 50S ribosomal protein L35
MKAKKAFLKRFKVTKNGKILRRVAGQNHYRSKKTGAAKRKGRKMVLVSKSEIKRLRRYLQLKV
Molecular weight: 7.43 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,105 |
3 |
1,108 |
297,384 |
25 |
1,582 |
269.1 |
30.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.57 |
1.36 |
5.24 |
7.14 |
5.19 |
6.03 |
1.31 |
9.12 |
9.75 |
9.08 |
2.07 |
5.98 |
3.33 |
3.33 |
3.65 |
6.42 |
4.85 |
5.95 |
1.13 |
3.5 |
Note: For statistics only major isoforms were used (in this case 1,105 proteins)
For dipeptide frequency statistics click
here