gamma proteobacterium HTCC2207
Average proteome isoelectric point is 5.89
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,388 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q1YQD5|Q1YQD5_9GAMM Cadherin domain protein (Fragment)
TDVDSDLVTFSVDSTELAISSGGVLSFIAAADFEAKSAYSVTVTATDGTNTATQIIAITVTDADEDAPVISSSPAFSAAENQTAIGSVLATDAGSLSFSISGTELAISSEGVLSFVSTPDYETKATYTATVTVTDAGSLATSQNITVAVTDIDDVAPVFTSEASFSAAENQTSIGTVTATDVDSDLVTFS
VDSTELAISSGGVLSFIAAADFEAKSAYSVTVTATDGTNTATQIIAITVTDADEDAPVISSSPAFSAAENQTAIGSVLATDAGSLSFSISGTELAISSEGVLSFVSTPDYETKATYTATVTVTDAGSLATSQNITVAVTDIDDVAPVFTSEASFSAAENQTSIGTVTATDVDSDLVTFSVDSTELAISSG
GVLSFIAAADFEAKSAYSVTVTATDGTNTATQIIAITVTDADEDAPVISS
Molecular weight: 43.07 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q1YRU1|Q1YRU1_9GAMM Uncharacterized protein
MKASAKKVIRQRSAWLASMFGCAAFLLMAVKLYNVSLSSLASNLVIVLFMLVIIVGAAAALGWVIARVRMRRK
Molecular weight: 7.98 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,373 |
15 |
2,388 |
775,132 |
21 |
2,403 |
326.6 |
35.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.69 |
1.02 |
5.94 |
6.06 |
3.91 |
7.62 |
1.98 |
6.15 |
4.29 |
10.26 |
2.61 |
3.84 |
4.34 |
4.15 |
5.04 |
6.85 |
5.2 |
7.05 |
1.23 |
2.76 |
Note: For statistics only major isoforms were used (in this case 2,373 proteins)
For dipeptide frequency statistics click
here