Breda virus 1 (BRV-1)
Average proteome isoelectric point is 7.0
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 6 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P0C0V9|HEMA_BRV1 Hemagglutinin-esterase
MLSLILFFPSFAFAATPVTPYYGPGHITFDWCGFGDSRSDCTNPQSPMSLDIPQQLCPKFSSKSSSSMFLSLHWNNHSSFVSYDYFNCGVEKVFYEGVNFSPRKQYSCWDEGVDGWIELKTRFYTKLYQMATTSRCIKLIQLQAPSSLPTLQAGVCRTNKQLPDNPRLALLSDTVPTSVQFVLPGSSGTT
ICTKHLVPFCYLNHGCFTTGGSCLPFGVSYVSDSFYYGYYDATPQIGSTESHDYVCDYLFMEPGTYNASTVGKFLVYPTKSYCMDTMNITVPVQAVQSIWSEQYASDDAIGQACKAPYCIFYNKTTPYTVTNGSDANHGDDEVRMMMQGLLRNSSCISPQGSTPLALYSTEMIYEPNYGSCPQFYKLFDT
SGNENIDVISSSYFVATWVLLVVVVILIFVIISFFC
Molecular weight: 46.44 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|O90306|NCAP_BRV1 Nucleoprotein
MNSMLNPNAVPCQPSPQVVAIPMQYPSGFSPGFRRQRNPGFRPMFNRRRNNNGNQNRGRQNRQRVQNNNRGNIRNRQNNGQRGNRRQYNQPSPNVPFEQQLLMMANETAYAATYPPEMQNVAPTKLVKIAKRAAMQIVSGHATVEISNGTEDSNKRVATFTIKVVMN
Molecular weight: 18.97 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6 |
0 |
6 |
13,577 |
167 |
6,733 |
2262.8 |
256.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.81 |
3.26 |
5.27 |
4.31 |
6.19 |
5.07 |
2.21 |
4.46 |
4.92 |
9.95 |
2.11 |
4.38 |
4.61 |
4.93 |
3.61 |
7.79 |
5.74 |
9.79 |
1.45 |
5.11 |
Note: For statistics only major isoforms were used (in this case 6 proteins)
For dipeptide frequency statistics click
here