Sphingomonas sp. Root710
Average proteome isoelectric point is 6.7
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,422 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q8Q6M0|A0A0Q8Q6M0_9SPHN Uncharacterized protein
MATYIFEEMTSEDAENFAPGDILRFSSAAATPANVSVSSTGLDITFVTSGGKTLAFTGADLAGAGSIDFVSSFIAGTDSTIVLGDGTDNDFAFTTNADGNYAYGFAGDDSIQGGSGADNIFGGTGDDSLVGNDGHDNLFGGAGDDTLEGGDGNDHLYGFGLTGDPSTDTDDEINGGSGNDYIQGNAGEDQ
LYGDDGSDRINGGGDNDYIQGGSENDTVNGNKGEDTIYGENGNDSLRGGADNDLVGGDAGNDVILGDLGDDTIDGGDGIDILTGGAGADVFVFDTLDAPIASTDEESDVFGLVDTVTDFTVGTDVLDITLTGLNAASDIVLQGDGVTFSTAAAAQTYASSLLVNHATGAIAAMQVGADTYLFYDSDGEYT
VDTTIDSAIKLTGVTAADLTTDDFGIVVAP
Molecular weight: 41.23 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q8QB89|A0A0Q8QB89_9SPHN 50S ribosomal protein L34
MKRTFQPSNLVRKRRHGFRSRSATPGGRKVLAARRARGRAKLSA
Molecular weight: 4.99 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,398 |
24 |
4,422 |
1,386,167 |
29 |
1,722 |
315.2 |
34.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.26 |
0.8 |
6.09 |
5.3 |
3.56 |
8.92 |
2.05 |
5.39 |
3.02 |
9.84 |
2.46 |
2.53 |
3.02 |
5.26 |
7.42 |
5.35 |
5.06 |
6.95 |
1.38 |
2.33 |
Note: For statistics only major isoforms were used (in this case 4,398 proteins)
For dipeptide frequency statistics click
here