Flavobacterium aquatile LMG 4008
Average proteome isoelectric point is 6.66
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,995 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A095SQ05|A0A095SQ05_9FLAO Uncharacterized protein (Fragment)
PAGNYTLTYQICQVTNPTNCDTAIVTVPVYTPSIELLKEGTYVDSNLPSGVSVGDTITYAFTITNTSTIALTNIIITDPIVTIIGGPLATLAAGASDSTTFTAVYTVTQADIDAGQVNNLATATGTPPSGPPATDDSSDPTPCTTCEPVVGCPTCTITPLIDAVNDTYNSVACDGTGTIGNILSNDTYGS
NPVNSNSNSQVTLTILSGNNPNIIIDNSGAITMTSAVPVGSYTYTYQICSTVSPNTCDIATVIINIIDTTDPTWTTPIPLPQDITVSCSNIPVTPILTATDSCSTPIVTHVQIITPGNCQGNYTIVNTWTATDASNNDIVHVQTITVQDTTAPTFVETLPTNVTFLLFKILQLLY
Molecular weight: 38.02 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A095U4U4|A0A095U4U4_9FLAO 50S ribosomal protein L34
MSKRTFQPSKRKRRNKHGFMDRMASANGRKVLARRRAKGRHKLTVSSEPRHKK
Molecular weight: 6.3 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,988 |
7 |
2,995 |
980,531 |
46 |
2,404 |
328.2 |
37.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.1 |
0.78 |
5.35 |
6.47 |
5.56 |
6.05 |
1.59 |
8.37 |
8.19 |
9.08 |
2.19 |
6.68 |
3.36 |
3.27 |
3.03 |
6.7 |
5.97 |
6.24 |
0.97 |
4.05 |
Note: For statistics only major isoforms were used (in this case 2,988 proteins)
For dipeptide frequency statistics click
here