Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
Average proteome isoelectric point is 7.69
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,570 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A3DPV9|A3DPV9_STAMF Amylopullulanase
MLTIIILLIIASQFAITTRLITVSTISPGTVIYSFDDPLGDDNGYGNITYPTDSVFQPGVFDLVKFQIEDTASTLYFKVTLDNLGDNPWNGPNGFSLQYIQIYILTSNQTLPVNYTTSGLNVMVSHGWNYAVLMVPGWDTAPVPNGQLSAIYDANGNVVAVEGSTPGFDVYVDPNINNTIVASIDKTLLY
DTQNLPLWKIAVVVAGYDGYAPYKVRQVVAGNSTQWEFGGGDPAAINAGVQPEVIDLLAPTANDQYQMLSSYNASTGTPANITGISVSSMTSTTITTTTPTTTTPPPQTVFEMNDPLGDDNGYGNITYPTDSVFQPGVFDLAGFKVVDAGSTIQFYVYLDNLGDNPWNGPNGFSLQYIHIYIYTGDSSLP
VNTTSFGENVDYSPGWHMAILLTPGWDTAPVPNGQLSAIYYYNGTAYAQDNNLFKVYVDTSNNTIIAEVDKSLLLDTNIINNWKYAVIMTGYDGYQPDKVRKVVAGNSTQWEFGGGDPAAINAGVQPYVIDLLAPTSSEQYQMLSSYDPAAGTRAVVYVQYPVTTPTTTTTTTTSPTNTTTTTTTTTTTA
TTTTTPPPTNTTTTSPPTTTTTTTTTTTTTSPTTTTTTTTTTTTTPPTGGGEIIPEKGQGQGSSWVTWAIIVAIVAAVAVIGYFVYRFYKSW
Molecular weight: 71.05 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A3DNH3|RL39_STAMF 50S ribosomal protein L39e
MARNKPLARKLRLAAAYKENRPVPIWVSVKTRLKVRRGFRLRHWRRTKLKV
Molecular weight: 6.22 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,566 |
4 |
1,570 |
453,003 |
36 |
1,701 |
289.3 |
32.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.83 |
0.63 |
4.67 |
6.84 |
3.58 |
6.46 |
1.75 |
10.41 |
7.52 |
10.39 |
2.24 |
4.23 |
1.75 |
4.37 |
5.43 |
5.66 |
4.78 |
7.16 |
1.17 |
5.15 |
Note: For statistics only major isoforms were used (in this case 1,566 proteins)
For dipeptide frequency statistics click
here