Cryptosporangium arvum DSM 44712
Taxonomy: cellular organisms; Bacteria; Terrabacteria group; Actinobacteria; Actinobacteria; Frankiales; Cryptosporangiaceae; Cryptosporangium; Cryptosporangium arvum
Average proteome isoelectric point is 6.59
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 4,033 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|A0A010ZW79|A0A010ZW79_9ACTN Mycofactocin
MPVETLESTAATETVEVDLVEEDLLVEDVSIDGMCGVY
MPVETLESTAATETVEVDLVEEDLLVEDVSIDGMCGVY
Molecular weight: 4.1 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A010ZQ11|A0A010ZQ11_9ACTN Uncharacterized protein
MVSTVRKIRTVRTVSDVHTVRNIRTSRSVCTMSTVRISRNVRTSRNVCTMSTVRTSRNVRTMSTVRTSHNVRTMSTVRTTRNVRTMRALRFVRPVRLIPALRHVSTLRHVGTLHFVRINGKRLSERDAQRILRRLHRRRSLRRRAVLRGTVQQRTLRRPTLQRRTLRRRSAHELRRGKQLRRSRSRLKIG
WIGHTVRLRRVVNKPPAPISDHPRSRILQCRRVLQRGRPGLHVRIRRQAEIRPGPPRPLPPPIAVPVNEQQRPGHSRRRRRTLR
MVSTVRKIRTVRTVSDVHTVRNIRTSRSVCTMSTVRISRNVRTSRNVCTMSTVRTSRNVRTMSTVRTSHNVRTMSTVRTTRNVRTMRALRFVRPVRLIPALRHVSTLRHVGTLHFVRINGKRLSERDAQRILRRLHRRRSLRRRAVLRGTVQQRTLRRPTLQRRTLRRRSAHELRRGKQLRRSRSRLKIG
WIGHTVRLRRVVNKPPAPISDHPRSRILQCRRVLQRGRPGLHVRIRRQAEIRPGPPRPLPPPIAVPVNEQQRPGHSRRRRRTLR
Molecular weight: 32.44 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
1,368,665 |
13 |
14,508 |
340.5 |
36.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
14.16 |
0.66 |
6.16 |
5.21 |
2.77 |
9.22 |
2.06 |
3.31 |
1.61 |
10.74 |
1.51 |
1.71 |
2.49 |
6.08 |
8.25 |
5.2 |
6.1 |
9.35 |
1.51 |
1.91 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |