Human papillomavirus type 4
Average proteome isoelectric point is 5.85
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 7 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q07857|VE7_HPV04 Protein E7
MRGAAPTVADLNLELNDLVLPANLLSEEVLQSSDDEYEITEEESVVPFRIDTCCYRCEVAVRITLYAAELGLRTLEQLLVEGKLTFCCTACARSLNRNGR
Molecular weight: 11.13 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q07849|VE2_HPV04 Regulatory protein E2
MESLVARFDALQEAILTHIESQESTLESQIQYWENIRKENAIMHYARKQGLTKLGLQPLPTLAVTEYNAKQAIQIHLTLQSLLKSPFASERWTLTDVSAELINTSPQNCLKKGGYDVAVWFDNDRQNAMLYTNWDFLYYQDMNEQWHKVKGEVDYDGLYFTDHTGERAYFTLFSSDAQRFSRTGLWTVHF
KTQVISSPIVSSTYSSSFDTEEQQLPGPSTSYSEVTEQASPTRRRKPRKSDATSTTSPETEGVRLRRRRREGKSGPGSGETPRKRRRGGGRGGGETELGSAPSPAEVGSRHRQVERQGLSRLGLLQAEARDPPMILLKGTANSLKCWRYRKVNSNCCNFLFMSTVWNWVGDCSHNHSRMLIAFDSTDQRD
AFVKHNLFPKLCTYTYGSLNSL
Molecular weight: 45.75 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7 |
0 |
7 |
2,459 |
100 |
599 |
351.3 |
39.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.73 |
2.4 |
6.67 |
6.18 |
4.31 |
5.9 |
1.87 |
5.25 |
5.0 |
9.68 |
1.79 |
4.27 |
4.6 |
5.94 |
6.02 |
8.13 |
6.14 |
5.16 |
1.3 |
3.66 |
Note: For statistics only major isoforms were used (in this case 7 proteins)
For dipeptide frequency statistics click
here