Virtual 2D-PAGE plot for 4,347 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|D4Z7A9|D4Z7A9_SPHJU Uncharacterized protein
MATVDLLTGDGTVAQVALPTTPQGVQQGLAPVGTLAGSLLGAPAGEAVTQLTDGLSPAVAAVTSTVGQLAAPLLDTVNGALSPVTDPLVGGNGVLAPVTGLVENAVGGLTGALGGIGGDPSAALGGPLIGANVGGDVLTGASTSGTLVGVNLLPSDGGAVAGQLATVDVLTQGNLVDVTVPTTAAGVEAG LQPAGNLAGGLLGPQAETTVNQVVSAVAPVVATVTSTVDSVAAPLLDTVNSLAPTLPGGESGSPLAPVTGLVDGLLGGGEGATGNVLAPVTGLLNGALAPATGSGSATAPVTGLLGGLLGGGN
Molecular weight: 28.72 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|D4YZ14|D4YZ14_SPHJU 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATPGGRNVLRARRARGRKSLSA
Molecular weight: 5.12 kDa Isoelectric point according different methods: