[Polyangium] brachysporum
Average proteome isoelectric point is 7.07
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,541 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G3BS51|A0A0G3BS51_9BURK Alkaline phosphatase
MEIFMAILDGNAGNDVLIDFSADPNSTLNGNLSGGDDVMIGHTGDDTYFVNSAGDLVVEFAGEGSDTVVSSLGAYTLGVNVENLTLNNTAPVVALNGTGNELNNVITGNNANNVLSGLDGNDTLNGENGADTLNGGNGNDTLSGGNGGDALNGDAGNDILSGGNGADTLNGGAGNDTLNGDDGADALNGG
AGNDTLNGNNGADTVEGGAGDDTLNGNNGIDMLSGQAGNDTLSGDNGADELNGGVGNDTLTGGNGSDTFVFGNRGAGNADTITDFVVANDSIVLLDALDAGLAGAISPGVLGLTFAGGNNPGNPLALASFFKGANVSGNAAGNTSGIYIDTVDGEIWYNPTTAAGGDAELLGTVTVGAAAALTQNDFIYG
A
Molecular weight: 37.0 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G3BW47|A0A0G3BW47_9BURK 50S ribosomal protein L34
MKRTYQPSKVRRARTHGFLVRMKTRGGRKVINARRAKGRKRLAV
Molecular weight: 5.19 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,183 |
358 |
5,541 |
1,747,373 |
33 |
10,822 |
337.1 |
36.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.8 |
0.94 |
5.36 |
5.51 |
3.26 |
8.35 |
2.45 |
3.5 |
2.68 |
10.98 |
2.06 |
2.28 |
4.25 |
5.61 |
7.71 |
5.29 |
5.19 |
7.9 |
1.58 |
2.3 |
Note: For statistics only major isoforms were used (in this case 5,183 proteins)
For dipeptide frequency statistics click
here