candidate division Kazan bacterium GW2011_GWA1_44_22
Average proteome isoelectric point is 7.42
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 335 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1KYA4|A0A0G1KYA4_9BACT Polymorphic membrane protein (Fragment)
MKIGWVGMIGIGLILIFGQVGQGRTDTGVPEVIINEVAWAGSSASSSDEWIELKNTTDADIDLSGWQITINALDITLPENSIIPANGFYLIAKYKTGHPNSALNVAVDLDRESKQFSISNNGFVITLQDATGQTEDIAWDSTKLPSSGYGYRNSDDSGSASLERKAPIGKGDDKTSWQEATDSINFDDIK
DLGTPKADNSIPPAILPSPIITSITPEETLAIDDFVLDQIDGDNFAMTNGLQIKLQNGTQEIWATDWQVLSPMLIINIEFDLTDAETGAWDVVVINPDQPPAILMNALTILELEDEPGDYSNADIQISEIYPHPTTGANSEFIELYNAGDNSVNLKGWQLDDQFPGGSAVYTINTDTIIESHQYYVFEKL
QTKISLNDTGDYVRLLNPQAALVETTPNYGSANLGEAYAKINDSWEWTLRPTPQAANVWENPIEPEEETTPTDDDPYSLQPNEIVIALDYDDLTSTSVLLTWQISLIGAIGELELYQSD
Molecular weight: 54.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1K9U4|A0A0G1K9U4_9BACT Fused DNA topoisomerase I/SWI domain-containing protein
MAVKRRKKTVKKKAAPKRKVAKRKAAPKKRKAAPKKRKTARRKKK
Molecular weight: 5.26 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
333 |
2 |
335 |
98,708 |
28 |
2,442 |
296.4 |
32.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.35 |
0.59 |
5.35 |
5.4 |
3.89 |
7.31 |
1.74 |
7.62 |
6.47 |
9.79 |
2.07 |
4.46 |
3.83 |
4.32 |
4.69 |
6.24 |
6.08 |
7.33 |
1.37 |
3.11 |
Note: For statistics only major isoforms were used (in this case 333 proteins)
For dipeptide frequency statistics click
here