Human picobirnavirus (strain Human/Thailand/Hy005102/-) (PBV)
Average proteome isoelectric point is 7.02
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q50LE5|CAPSD_HPBVH Capsid protein precursor
MKQNDTKKTTQRRNSKKYSSKTNRGTKRAPRDQEVGTGAQESTRNDVAWYARYPHILEEATRLPFAYPIGQYYDTGYSVASATEWSKYVDTSLTIPGVMCVNFTPTPGESYNKNSPINIAAQNVYTYVRHMNSGHANYEQADLMMYLLAMDSLYIFHSYVRKILAISKLYTPVNKYFPRALLVALGVDPE
DVFANQAQWEYFVNMVAYRAGAFAAPASMTYYERHAWMSNGLYVDQDVTRAQIYMFKPTMLWKYENLGTTGTKLVPLMMPKAGDNRKLVDFQVLFNNLVSTMLGDEDFGIMSGDVFKAFGADGLVKLLAVDSTTMTLPTYDPLILAQIHSARAVGAPILETSTLTGFPGRQWQITQNPDVNNGAIIFHPS
FGYDGQDHEELSFRAMCSNMILNLPGEAHSAEMIIEATRLATMFQVKAVPAGDTSKPVLYLPNGFGTEVVNDYTMISVDKATPHDLTIHTFFNNILVPNAKENYVANLELLNNIIQFDWAPQLYLTYGIAQESFGPFAQLNDWTILTGETLARMHEVCVTSMFDVPQMGFNK
Molecular weight: 62.03 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q50LE6|ORF1_HPBVH Uncharacterized ORF1 protein
MTANQIAYQKHLETARVNAVGEMQRGLELDESRRHNISQEQLKTRELTELERSNRAVEKETSRHNVVTETETRRSNLAREWETYRSNSAREMETQRSNISYEAIKRGQLALDRAELNESIRATNENLALQYSKLQTESLLTQRGQDLQHKNAIIGASANAFGSLLGYSTASADRASREEIASANRKSQEH
IASMQVLGSMANTMFSSVSNLVGKTAGAFAGGLS
Molecular weight: 24.93 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
1,310 |
224 |
552 |
436.7 |
49.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.02 |
0.92 |
5.27 |
5.73 |
3.59 |
6.41 |
2.06 |
4.43 |
4.96 |
8.24 |
3.89 |
5.27 |
4.5 |
4.27 |
5.73 |
6.87 |
6.49 |
6.87 |
1.76 |
4.73 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here