Actinomyces sp. oral taxon 180 str. F0310
Average proteome isoelectric point is 6.31
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,070 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E6KPC6|E6KPC6_9ACTO Uncharacterized protein
MRVMTGDARRALTRLLNAFENHFDIARDGDEADDAALEAAELALRDAFFTYDDILFTQLGVELPFDIFDDSDEDEEDPEDYDEDDDFVEVDD
Molecular weight: 10.56 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E6KTA4|E6KTA4_9ACTO Uncharacterized protein
METAPPTHPPLLRRTSPSKKPWAAPTSSRTVEGLQQTRPPPTRTRPQTQGRLATAPGTQMAPVRLIPTLSRGTIPASARTLTPRRRTTPPTVRPTTPLIRRATATRPRPRKTSRTSPRRISPTRKTTPTASPIRTRPTRTSPTRIRPSAQTPIRRRRTTPPTARPTTPLTRRATVTRPRPTNPRRTSPTR
KTTPHTTTATSTPRTPTTSTPPRTARPTPTPSPTTIRPSTRTPIRRRRITLPTARPTTLLIRRTAATSPRPTRARQISPPRTSLTRQTTPHTTTTPSTPRTPTARPPRRTPTRSRRTTPPTTRQTTPTIRRAAATSPRPTRPRQISPPRTSLTRQTTPHTTTTPSTPRTPTATPSPTRTPTTRSTPRKRT
HPSTTRTRTSRRVPTQQQTSMPATGGPTTLRMPGRTATRKRQVHLPKTPTASIPMILLERTASPSPLTATPAIHRAMSTARSTEIVTPTAIRASTKALRVTKVRRKRSTRICTITHTMAR
Molecular weight: 55.38 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,061 |
9 |
2,070 |
691,066 |
37 |
3,083 |
335.3 |
36.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.84 |
0.82 |
5.97 |
5.73 |
2.88 |
8.85 |
2.01 |
4.65 |
2.39 |
9.28 |
2.2 |
2.25 |
2.91 |
5.33 |
7.14 |
6.63 |
6.03 |
8.36 |
1.52 |
2.2 |
Note: For statistics only major isoforms were used (in this case 2,061 proteins)
For dipeptide frequency statistics click
here