Microgenomates group bacterium GW2011_GWC1_37_12b
Average proteome isoelectric point is 7.44
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,051 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0IN82|A0A0G0IN82_9BACT Uncharacterized protein
MTLKKKLTTAVATAALFMNFALPVAAQTISGNNSDSENYINTDVDYDFDLDQNNDADVENSVNISLDSGGNKVKDVVGGEVEIETGDLEAGVQVMNQLNMNVASFDVCGSCGMTGDFKIADNNSGSDNDIDYDYESDFDLDQDNDADVENDVDVTGKTGDNEVDDTMNGDVSVKTGDVTVNPIIIKNALN
ANWAVVSSSDEEEDGVSAWILGNNSDSDNFINLDFDHDTDVDQDNDADVENDVAVSAKTGYNDVDDVAGAGVSIDTGDVEVGVMIDTMANFNMAAVEDCCFLGDQETKIADNNVDSDNDIEVDLDLDFELDQDNDFDCGTSKGWFDNFLRGYEGGSDCNEVDVTGGTGDNEVEDAAAGGHDPEITTGDAA
AAVQLSTSANVNVEGGAGVDFDVDFGEVADMLGDLFDLLD
Molecular weight: 44.46 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0J8Q0|A0A0G0J8Q0_9BACT 50S ribosomal protein L35
MPKLRTRKSITKRFRVTKNGKVMRMQGFHGHLNEKKTASRKRRLSRVVMTKKTHAKKIKTALGM
Molecular weight: 7.52 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,049 |
2 |
1,051 |
295,021 |
35 |
1,672 |
281.2 |
31.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.04 |
0.68 |
5.07 |
6.26 |
5.22 |
6.7 |
1.45 |
8.28 |
8.47 |
9.77 |
1.93 |
5.13 |
2.76 |
3.95 |
3.94 |
6.8 |
5.65 |
7.02 |
1.18 |
3.7 |
Note: For statistics only major isoforms were used (in this case 1,049 proteins)
For dipeptide frequency statistics click
here