Virtual 2D-PAGE plot for 3,238 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0E3L6M5|A0A0E3L6M5_9EURY Secreted and surface protein containing fasciclin-like repeats
MLFASGCAEEQPEEEVEEPVDEGTEEEMVEEEEMIEEEEIAEEEEMAEEEMPEEEMPEEEEAVVEEEMAEQAAEGMAGEENITEDEMAEDEMAEDEMAEDEMAEDEMAEDEEEMNIVETAASSDDFDTLVTAVQTAGLEEALSGEGPFTIFAPTDDAFDDLPPGTLDDLLEDEDALTDVLLYHVAEGEFD VTEIESVETMQGEELPVDPTSDPITVGDANIIGDRIETSNGFIYPIDEVLIPPE
Molecular weight: 26.99 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0E3L605|A0A0E3L605_9EURY Uncharacterized protein
MARGRGRRRKSGTFDNFSRNMQRPVMKAGGNDISLLQVLLISIILYFLLRFLLPLIWVLALIVALVVLIKVVLKML
Molecular weight: 8.68 kDa Isoelectric point according different methods: