Burkholderia sp. TJI49
Average proteome isoelectric point is 7.09
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 8,940 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F0GGS0|F0GGS0_9BURK Uncharacterized protein (Fragment)
ASIGGTTLNNAVNLGAGSALTLGGTNDLGLGGIISGGGSLAQTGTGTTSLTGPNTYTGGTTLSAGGLSVGSNTALGTGTLGVSGAGGALSASTANLLLANAVDLGAGSALNLGGAFDFGLNGIISGAGSVVQSGSGTTTLGGANAYTGGTTLNSGGLSVGSNTALGSGALNVTGNGTLSASVNGTTLGNA
VTLGGGATLGLNGANDLGLSGTISGSGGLAQTGAGTTTLTGTNTYDGGTTLSGGGLMAGNGSALGSGALNVTGAGGSLGTNVGGTTLGNAVNLGAGATLTVGGANDLGLGGAISGSGNLSVTGPSTTTL
Molecular weight: 28.28 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F0GKA3|F0GKA3_9BURK Uncharacterized protein (Fragment)
MPPPRAIASSMRANARGGARIPRNGKRRRRA
Molecular weight: 3.43 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8,830 |
110 |
8,940 |
2,087,643 |
14 |
2,818 |
236.4 |
25.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.35 |
0.95 |
5.81 |
4.7 |
3.7 |
8.38 |
2.35 |
4.56 |
2.8 |
10.13 |
2.33 |
2.63 |
3.39 |
5.18 |
7.33 |
5.26 |
5.41 |
7.8 |
1.4 |
2.53 |
Note: For statistics only major isoforms were used (in this case 8,830 proteins)
For dipeptide frequency statistics click
here