Microgenomates group bacterium GW2011_GWC1_38_12
Average proteome isoelectric point is 7.41
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 1,187 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0IK70|A0A0G0IK70_9BACT Uncharacterized protein (Fragment)
MTGDGVDKQIAFFTGTSTLDSEATGFAWDYTNNKLGIGDDTPEGIVDIDGAATGQALLQLRETGDQNIITATASSTTVFNLTRNGLIEAADLTLGLNDTTATIATYDTNEDLTLDPNGTGDIYFHGGSYSINDSGQATFATDETINGIDISSGAVSDVVDLAMVLGAGNDITIDAAATDNTGTTGIINLD
LDATSSQQAINLDIETITDAGIDTLIGLDILATQTSTDDDIIYGIRVQNLAGLADSGAEYGIYQAGTSWDYG
Molecular weight: 27.08 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0IEN0|A0A0G0IEN0_9BACT YcfA family protein
MSKLPVVSVNKAIRAFKKLGYLQTRQRGSHIRFRHPNSFRKPLSIPNHKVLGRGLLRKLIRDANISVEEFKKLAK
Molecular weight: 8.69 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,181 |
6 |
1,187 |
329,875 |
30 |
1,361 |
279.3 |
31.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.12 |
0.64 |
4.95 |
6.89 |
5.3 |
6.67 |
1.51 |
8.1 |
8.4 |
10.18 |
1.88 |
4.44 |
2.89 |
4.06 |
4.51 |
6.5 |
5.22 |
6.83 |
1.27 |
3.65 |
Note: For statistics only major isoforms were used (in this case 1,181 proteins)
For dipeptide frequency statistics click
here