Micromonospora lupini str. Lupac 08
Taxonomy: cellular organisms; Bacteria; Terrabacteria group; Actinobacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora; Micromonospora lupini
Average proteome isoelectric point is 7.01
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 6,991 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|I0L4F6|I0L4F6_9ACTN Putative outer membrane adhesin like protein
MRIRASVAAVLAALLLSGGLAVAGGAVAQADPGADPCATTDGDPIMGTAGDDILYGGSGPDEIYGLGGDDEIYGGGGVDTILGGTGDDILFGNGCGDTLVGGPGDDVLAGLDGDDYLSGANGADLLIGEAGVPIWGVVTDGDTLDGGPGVDTCAEDDEPDSAVIFYYYIDTGAGDENLYSC
MRIRASVAAVLAALLLSGGLAVAGGAVAQADPGADPCATTDGDPIMGTAGDDILYGGSGPDEIYGLGGDDEIYGGGGVDTILGGTGDDILFGNGCGDTLVGGPGDDVLAGLDGDDYLSGANGADLLIGEAGVPIWGVVTDGDTLDGGPGVDTCAEDDEPDSAVIFYYYIDTGAGDENLYSC
Molecular weight: 17.63 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|I0LAX8|I0LAX8_9ACTN Uncharacterized protein
MALIVRRLVGWIVRRLVGWIVRRLVGWIVRRLVGWIVPRLVGWIVPRLVGWIVRRLVGWIVRRLVGLIVPRVPLGLPTVVAVTSAAAAMIIPMSTPPTPSRLAAVPLRAVIPRAAVLLAAVPLAADLPMAVLPAPVPRPGVLLVAVPLAAVLPAVIPRAAVSPAVIPRAAVSPAPVPRAAVRR
MALIVRRLVGWIVRRLVGWIVRRLVGWIVRRLVGWIVPRLVGWIVPRLVGWIVRRLVGWIVRRLVGLIVPRVPLGLPTVVAVTSAAAAMIIPMSTPPTPSRLAAVPLRAVIPRAAVLLAAVPLAADLPMAVLPAPVPRPGVLLVAVPLAAVLPAVIPRAAVSPAVIPRAAVSPAPVPRAAVRR
Molecular weight: 19.46 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
2,110,162 |
20 |
2,459 |
313.4 |
33.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
14.01 |
0.74 |
6.11 |
4.86 |
2.58 |
9.42 |
2.09 |
3.1 |
1.54 |
10.54 |
1.57 |
1.79 |
2.8 |
6.42 |
8.56 |
4.87 |
6.29 |
9.03 |
1.62 |
2.04 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |