Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Average proteome isoelectric point is 6.99
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,730 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B9L8B6|B9L8B6_NAUPA Uncharacterized protein
MKILLITSNATIEKLFVLSAEKKGDEVIIGTAENIPEGTFDAVFVDKDLYSDELFENLKMLFPDAKFVLIVSKNDEKIVGFNDYLTKPFLPTDLMELLEKLPNMKDNEQNIEEEDIDIESFEDLKDLDIDMEDSSDIESLDELDDLEDDLDFDLEEDILDSELEEKINEEPSEVNTDEKEENIDIEDMFE
DLESEEDLKNLDVRDEFVAGDEDDFEISEEELEGEAPDDDIEESFELDEKELVDSEEKEENLDEELLNEIEANTQSEESGMEDINNEAVVEEEKVEELDEVIQEPQEPEEEILESIEEPAEEINEDFDLDDLIQEEQNQENIEESIDQPVETIEELPEEVEEVKNNEDMVENNLEELLETSEQLSEEPEE
VNIQETEDEHENLEEFDLEEIGNETEPIEEKIEEVSEEPQESQESEKEILESVDETVEENMNVDEANIEEIEDLDEELTNLDESQLAEVLGEEVPQEENEENIDNLEEINEESVEEINIDDKIPEIQEAHELENIIKEPTMEEKTLGSVLNINWEELKKAKAKVTITIDFGD
Molecular weight: 63.9 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|B9L9D4|RL34_NAUPA 50S ribosomal protein L34
MKRTYQPSKIRRKRTHGFRARLKTKNGRKVLARRRAKGRKRLAV
Molecular weight: 5.33 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,724 |
6 |
1,730 |
517,295 |
37 |
1,668 |
300.1 |
34.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.23 |
0.81 |
5.42 |
7.66 |
5.43 |
5.69 |
1.56 |
9.54 |
10.37 |
9.46 |
2.33 |
5.8 |
2.31 |
3.24 |
3.15 |
5.18 |
4.57 |
6.27 |
0.71 |
4.26 |
Note: For statistics only major isoforms were used (in this case 1,724 proteins)
For dipeptide frequency statistics click
here