Zymoseptoria brevis
Average proteome isoelectric point is 6.47
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,566 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0F4GGS0|A0A0F4GGS0_9PEZI Uncharacterized protein (Fragment)
MTIPAGSSTLLPVASSTLPIDPSSVPPTGVPSGLPADLPSSTLVTGPTQITVSLPNGQASTLTIPAGSSTLLPVASPTLPGNPTSVVPTQAPSGLPADLPSSTLVTGPTQITVSLPNGQASTLTIPAGSSTLLPVASPTLPGNPTSVVPTQAPSGLPTNLPSNSLSIPNTSTELPDDGSNGADLTSLISE
AEETLPTELPELSVDASLTASVSLETPDVSGVVSAVTSLLGEVLPTPSTGLTLPIDSGLPTQSLPTSVDASVPQASGIISSLTSLIGNLFPSASTDLALPTGSGLPTQSLPTGLPTGLPSSVASNIEASLTSIIGGLPSNLPSSVVSEIGDSLTSAISDLTNLPAPTGTASNIPDVSSFVSDVQASLTSI
IGGVPSGLPSNSASDIEASLTSII
Molecular weight: 39.29 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0F4GTJ2|A0A0F4GTJ2_9PEZI 60S ribosomal protein L39
MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI
Molecular weight: 6.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,565 |
1 |
10,566 |
5,141,249 |
45 |
7,061 |
486.6 |
53.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.16 |
1.16 |
5.85 |
6.35 |
3.53 |
7.03 |
2.4 |
4.52 |
4.9 |
8.54 |
2.25 |
3.6 |
4.12 |
6.03 |
6.19 |
8.15 |
6.16 |
6.04 |
1.39 |
2.62 |
Note: For statistics only major isoforms were used (in this case 10,565 proteins)
For dipeptide frequency statistics click
here