Lactobacillus shenzhenensis LY-73
Average proteome isoelectric point is 7.05
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,142 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|U4TIQ0|U4TIQ0_9LACO Uncharacterized protein
MLSEPEAEVLVEVLSEPEADSDVESLVDAEADVLPDSEPEALVELLSEPETDSDSLAEVLSEPDAEALVDSEADALVEVLADSEPDVLADADSEPDALVDVLSEPEVLADSEADVLVEVLSEPDPDALPDVEPEALADVLSEVDADAEALVDSELLIDVLADSEPDVLAEALSEPEVDSLPDVDAESLAE
VLSEPEALADSEPDVLTELLSEPEADALVEVLADSEPEADSLPDAELDVLVEVLSEPEADPLVDSEVDAEALAEPLAELEVEPDSLPDDEVLADAEPDPLTELLSEPDVDVLVDSEADTEALAELLSEPDADSLPDADVLADSDAEALVDSDPDALVEVLADSELETEVLADSEPDTLVDALSDPDAESL
PDSDADALAEVEADVLSEPEAEAESLADADSEPLVDVLVESEAETLVDSESEALADVLAESDVETLVDSEEDVLVELLSEPEADALVDAEILCESDAEVLAEADSLPDAEAEVLVEAESEPDTDVLAESDTEVLVDVLPDSETDDESLAEADGAAESLVDAAALVDVDVAADAAAEADPAAPLVAAVDPA
IVVFDLVAKTCS
Molecular weight: 60.36 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|U4TU42|U4TU42_9LACO Uncharacterized protein
MQNFKGIQGILRIVALIGLLLAVVTFFVQSLRQFLPVAIVLAGVAGIAGQLVNRTPRPH
Molecular weight: 6.34 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,033 |
109 |
3,142 |
902,561 |
37 |
2,242 |
297.6 |
32.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.44 |
0.39 |
5.83 |
4.23 |
4.05 |
7.04 |
2.37 |
5.82 |
4.57 |
9.84 |
2.57 |
3.86 |
4.87 |
4.58 |
4.78 |
5.33 |
6.95 |
7.24 |
1.38 |
3.45 |
Note: For statistics only major isoforms were used (in this case 3,033 proteins)
For dipeptide frequency statistics click
here