Lactobacillus fabifermentans T30PCM01
Average proteome isoelectric point is 6.79
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,305 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|W6T5J8|W6T5J8_9LACO Collagen-binding protein (Fragment)
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSELR
Molecular weight: 55.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W6T4K1|W6T4K1_9LACO 50S ribosomal protein L34
MMKRTYQPKKRHRQRVHGFRKRMSTSNGRKVLARRRQRGRKVLSA
Molecular weight: 5.54 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,270 |
35 |
3,305 |
942,580 |
29 |
2,473 |
288.3 |
31.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.52 |
0.49 |
5.78 |
4.4 |
4.05 |
6.63 |
2.3 |
6.37 |
5.26 |
10.03 |
2.71 |
4.41 |
5.08 |
3.8 |
3.98 |
5.84 |
7.22 |
7.36 |
1.24 |
3.53 |
Note: For statistics only major isoforms were used (in this case 3,270 proteins)
For dipeptide frequency statistics click
here