Desulfobacula toluolica (strain DSM 7467 / Tol2)
Average proteome isoelectric point is 6.99
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,189 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K0NRX9|K0NRX9_DESTT Conserved uncharacterized protein associated with flagellar apparatus genes
MSDPGLEEDGLISQDDIDKLLDSSSIEEAEEILSNNVADGDDEFGELSQDDIDALMNSSVSVSENSIDEDDVEDDEMELISQDDIDQLMNSSVSDSEDPIDEDDVEDDDIELISQDDINDLMDSNDASDEDVELISQDDINTLMGGGSTEDISRDDGVIDESEAVDARNCLIVQETIDDLMRNFDTDVPS
EPVVLDEDPFLDSQPEPVDQTQFASDPGSQPEPDELNEEKASELDDIEDFLTPDSDVSAFDFDDEGVQEDENDFQDDIDAFLLEDEEGEEGEEGEEDYEDILISQDDIDTLLMVADQEDEDVLGDLMDNDFGSSLEDPVGEDEVGEDELSEPDNTDKEDEGQVVLEEEDHTEKSNKKARSKWYKSKFAVA
CASVLVVLGIAVPLTYFFFFSGETGESSHPKNVGEVAIETQREIEVETVDIHIEKQDNIKKSGNIILNDFVILASDLSKDMTYITVDISIDYSDQSAYFEIQNNLSFYRDLIYDSLNQSLVSEKREGITETDILWIVETALKKALPGPYIDRVSFKSFTAS
Molecular weight: 60.26 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K0NQ21|K0NQ21_DESTT 50S ribosomal protein L34
MKRTFQPSNRKRTRKHGFRKRMSTPSGRRVINARRAKGRKKLTV
Molecular weight: 5.28 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,155 |
34 |
4,189 |
1,444,826 |
32 |
3,944 |
347.7 |
39.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.92 |
1.38 |
5.77 |
6.2 |
4.83 |
6.69 |
2.05 |
8.16 |
7.81 |
9.47 |
2.75 |
4.65 |
3.49 |
3.85 |
4.27 |
6.23 |
5.25 |
6.16 |
0.96 |
3.12 |
Note: For statistics only major isoforms were used (in this case 4,155 proteins)
For dipeptide frequency statistics click
here