Candidatus Uhrbacteria bacterium GW2011_GWD2_52_7
Average proteome isoelectric point is 6.5
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 920 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1XBJ4|A0A0G1XBJ4_9BACT Regulator of chromosome condensation
MFACDVTSFADFVDAAGGDSSSLAYWSQVTQYEDTDGDGYEDTPSWDCDDEESAVYPGAEEVCDDMVNDCNAAEGTVADDGLAFMDYYMDMDSDGYGDATMSMNDCAAPDGYVEDNTDCDDTDGGISPGDVEICDEFDTDEDCDTFADDDDSSATGMTTWYPDMDSDGAGGDDSSSVDMCEQPSGYYAEN
TDCDDNDGSVIVETSWYYDGDGDGEGDESIATTPSCHAPTNYVDSYGDCDDANAAVNTDAVEVVNGIDDNCRDGIDEGVSCTVELNIFTDDAGAALWINGMVSDNVDLDGDWSVSDGASLWSTSVTSLGGSDWFYSIQFDHCLDSSTVITLEAEFADGTTFAESGTVYAWEDSDLLSVAGSGGTLSVTE
Molecular weight: 40.12 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G2ACZ5|A0A0G2ACZ5_9BACT Uncharacterized protein
MAAKKKAKKAAPKRKAVKKAAPKRKAAKRKARA
Molecular weight: 3.59 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
920 |
0 |
920 |
237,813 |
21 |
1,688 |
258.5 |
28.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.65 |
0.89 |
6.04 |
6.52 |
4.06 |
7.31 |
2.11 |
5.92 |
4.51 |
9.29 |
2.59 |
3.17 |
3.12 |
4.24 |
5.98 |
6.21 |
6.1 |
8.22 |
1.18 |
2.8 |
Note: For statistics only major isoforms were used (in this case 920 proteins)
For dipeptide frequency statistics click
here