Rice tungro bacilliform virus (isolate Philippines) (RTBV)
Average proteome isoelectric point is 7.11
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 4 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P27501|P4_RTBVP Protein P4
MNIEYPYSIHIIDKNKVPIYDQGNLFHTEKSSRLSHVSRGLLDHLFTFSSDNTERVRKLHILADYLYLLESERESYKNEWISLKDQVSLLQKQNSELRARIATNKEIIEGLREPVKKPIYTTQDKERLRVFFCEERSMEYIYYHIKRLAQQSYYSHLNNLQKDCEPFRGVYMSFLTNVKFLVLCEAGYWT
VPDIETNTTESILSLSQKKGEDLLQKGVVIFNELEGGYQLSPRFIGDLYAHGFIKQINFTTKVPEGLPPIIAEKLQDYKFPGSNTVLIEREIPRWNFNEMKRETQMRTNLYIFKNYRCFYGYSPLRPYEPITPEEFGFDYYSWENMVDEDEGEVVYISKYTKIIKVTKEHAWAWPEHDGDTMSCTTSIED
EWIHRMDNA
Molecular weight: 46.17 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P27499|P2_RTBVP Protein P2
MSADYPTFKEALEKFKNLESDTAGKDKFNWVFTLENIKSAADVNLASKGLVQLYALQEIDKKINNLTTQVSKLPTTSGSSSAGAIVPAGSNTQGQYKAPPKKGIKRKYPA
Molecular weight: 11.91 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4 |
0 |
4 |
2,373 |
110 |
1,675 |
593.2 |
69.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.42 |
1.39 |
5.94 |
9.31 |
3.96 |
4.26 |
2.02 |
8.39 |
10.62 |
8.09 |
1.81 |
5.9 |
3.75 |
3.46 |
4.34 |
6.49 |
5.9 |
4.21 |
1.26 |
4.47 |
Note: For statistics only major isoforms were used (in this case 4 proteins)
For dipeptide frequency statistics click
here