Desulfitobacterium hafniense (strain Y51)
Average proteome isoelectric point is 6.37
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,014 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q24P15|Q24P15_DESHY Putative uncharacterized protein
MAELTTGLIDNFPVNGVRPSVSVAIRITNDGDSVEMVEIIGYYLNGLFKEVYVLEELSIIPGEVVLREYFADLDAFEFVFSTSSETVVISVWGKDAEGNLVDAHRVLPAELDSLEPVIGPTGATGATGATGDTGATGATGATGDTGATGATGATGATGDTGATGATGATGATGATGATGATGATGATGAT
GATGATGATGDTGATGATGATGDTGATGATGATGATGATGATGDTGATGATGATGDTGATGVTGDTGATGATGATGDTGATGATGATGDTGATGATGATGDTGATGATGATGDTGATGATGATGDTGATGATGATGDTGDTGATGATGATGDTGATGATGATGATGATGETGATGATGGGAVIPFSSGDP
LAVTTLAGGLVGLPGLIGFGSSAQALTVLGATIDLSGQTNYAFSMPRDGVITSLAAYLSATAALALLAPLTYTVQLYSSPSPDDVFSPVPGAVVDITITGPIAVGDTFNGIATGLSIPVTGQTRLLLVVSATGGGLVAGGTVAGYVSAGLGIE
Molecular weight: 48.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q24VL1|Q24VL1_DESHY Putative uncharacterized protein
MVSTTLMSRIPPSSPPVVMNIFLARIRFMAASASTAVKSSLGAGKVRLKVLPKVVAKVKRRIFFCVLSAIFRPSLKQNSS
Molecular weight: 8.69 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,935 |
79 |
5,014 |
1,569,636 |
35 |
3,013 |
318.1 |
35.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.18 |
1.18 |
4.83 |
7.1 |
4.06 |
7.66 |
1.93 |
7.03 |
5.84 |
10.46 |
2.73 |
3.77 |
3.93 |
4.13 |
4.81 |
5.83 |
5.16 |
6.83 |
1.13 |
3.41 |
Note: For statistics only major isoforms were used (in this case 4,935 proteins)
For dipeptide frequency statistics click
here