Scedosporium apiospermum
Average proteome isoelectric point is 6.34
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 8,374 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A084G5J2|A0A084G5J2_9PEZI Uncharacterized protein
MVVDTATPGREAEAVDRRRESGAGEAGGDLELTTVLGLVAAGLVEGVTTVVVQSWGGWVVVTTGEDVVLGGLVVLEAMLLVVETTLEVEDELEVDDTSLEVEELVVETSLEVEELVVETSLEDEDELVVDSSLDVEEEVVDTSLEVEESVDETSLEVEELVVEASLDVEEADVSDVEDSVEEAEDSVVEV
EDSVEEAEDSVAEVEDSVVDVEDSVEVQDSVTEVEDSVEEAEDSVAEVENSVAEVEDSVVEVEDSVEEAEDSVAEVEDSVVDVEDSVEVEDSVTEVEDSVEEAEDSVAEVEDSVAEVEDSVAEVEDSVEEAEDSVAEVDDSVVEVDDSVEEAEDSVAEVEDSVAEVEDSVEEVEDSVAEVEDSVAEVEDS
VAEVEDSVELEDSAVEELVLETSVELEDSVELEASLEVEETVLETSVEVEDSVEVEETSLDVDEAVLEISLEVEDAVELTVELETIGTKIILHTRVGPDGQGWCKKSIDVDSTEVEGRGPGVLDEMSRHEGNEGL
Molecular weight: 55.12 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A084G225|A0A084G225_9PEZI Uncharacterized protein
MSSIMALLPISSRRRTLLLATSATATATAVLAFRYRISSATRRNELALAQAPARPNFHVTVDRSGGGI
Molecular weight: 7.26 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8,373 |
1 |
8,374 |
4,572,796 |
66 |
8,042 |
546.1 |
60.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.81 |
1.21 |
5.85 |
6.4 |
3.74 |
7.09 |
2.28 |
4.95 |
4.78 |
8.96 |
2.08 |
3.53 |
3.76 |
6.19 |
6.17 |
7.87 |
5.84 |
6.29 |
1.47 |
2.72 |
Note: For statistics only major isoforms were used (in this case 8,373 proteins)
For dipeptide frequency statistics click
here