Virtual 2D-PAGE plot for 13,022 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|B8MJ20|B8MJ20_TALSN Uncharacterized protein
MEVYINQIQSSSGAYEESCTQCELLDGAATLQCYCTGTFANESGNSTLNLEEYIANYDGHLLSSLEGTPSVPSDSSLAVPSNVVLSLNAFVGTGTSCPSNEGAYLNFVGPEPCWGLYVSPEPVVWSSFRATSNPGWSISVYNVSTCTGTPIVTFDQDSVNDCIAVGQDGGIYLSIMPLWNWD
Molecular weight: 19.4 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|B8MRT9|B8MRT9_TALSN Uncharacterized protein
MSTSTNMRVFRLRSAWRLSQTSRLSAPRYQNQFRSVATKQASPAYPQTSSTLNQAIPNPSPSTSLAVKKLVTPIHRTEDLWHPRSRHKGGRRVKLIRGRNRLWRIR
Molecular weight: 12.29 kDa Isoelectric point according different methods: