Virtual 2D-PAGE plot for 3,176 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0S8BYI3|A0A0S8BYI3_9PROT Uncharacterized protein
MAELLISSIDVEGGGTLEVYATENEGSITFHIKTADGWNPDYNLDLNGLFLEYQEDGSIKLTVDGEKANNLNGTTYEGEKIYWDLAESTGSTVGGSDGITSLMECTVTVEGLTLADIDGGLIGIRATSTGTDGEGSLKLVGEIVVPEAETTDSYPDFEKDISHATLVFNTTDGDTSGDGYYTVKIDEWTG SNDLDAELDAILAWLIENDENITAETELLGAQLKGGNVGTADGSYDDFWANDGDDSVDVVVVGYKQNGSEITEVTSTDAEPTNLDLEQNGTLNGSDVSYDYDVVIG
Molecular weight: 31.43 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0S8C5P5|A0A0S8C5P5_9PROT 50S ribosomal protein L34
MKRTYQPSVTRRKRTHGFRVRMRTRGGRAVIRARRAKGRARLSV
Molecular weight: 5.24 kDa Isoelectric point according different methods: