Staphylococcus pettenkoferi VCU012
Average proteome isoelectric point is 6.33
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,345 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|H0DF40|H0DF40_9STAP Uncharacterized protein
MGSALLTSLLFLGVSHSADAAEETPVAGDQDQNPLEYNVNNESNPTAGDQGQDPLEYNGNNESNPTAGDQNQDPLEYSGNNEENPTAGDQSQDPLADGSEEVNPIAGDQGQDPLEYDGSHEMNPIAGDQDQDPLEYNGNNEEDPIPGDQSQDPLADGSEEVDPTPGDQSQDPLADGSEEVDPTPGDQSQD
PLADGSEEVDPTPGDQSQDPLADGSEEVDPTPGDQSQDPLADEPATEDNQGTDASNGSNDATTDAEGNTVETDAEGNTIVTDAQGNTTVTDAEGNTTYTDVAGNTTVTDAEGNTTFTDVEGNTTYTDVEGNTTYTDAQGNTTVTDAQGNVVQQSTANAMTNEGAMGEEGAMDAQGTNGMTDNGMATGEES
QGTSEQGEDQGTQSKEDNEAGELPESGGSDMTVPLATSTAMLVARLGLLFRRRNTEK
Molecular weight: 45.29 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|H0DJT4|H0DJT4_9STAP 50S ribosomal protein L34
MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
Molecular weight: 5.43 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,342 |
3 |
2,345 |
675,159 |
31 |
1,820 |
288.3 |
32.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.65 |
0.61 |
6.19 |
6.96 |
4.32 |
6.38 |
2.63 |
7.86 |
6.72 |
9.26 |
2.71 |
4.78 |
4.44 |
3.39 |
3.95 |
5.96 |
5.67 |
6.87 |
0.78 |
3.88 |
Note: For statistics only major isoforms were used (in this case 2,342 proteins)
For dipeptide frequency statistics click
here