Pseudoalteromonas lipolytica SCSIO 04301
Average proteome isoelectric point is 6.2
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,974 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Z5XS66|Z5XS66_9GAMM Uncharacterized protein
MDANQLLVIDVQGSAGIIQADGSIKALSVGDVITVGDTVITADKSTLLIDVQGESLSIPANKKVTITPDLLAKEVKDSSENTVFDDSIDDAIASLNQPNQATPDPQQGGDISDFLDALEGGGDILDSLEATAAGGTGGATSGGGTSFVELARIAEGIDPSSLAFDDSFNSDSSGIFSPRDTTDGVVPTDT
LTATVSIDDPGVINNSQPVITGTTENLVGETVTVTVTDVNGNNQVVTVVVQPDGTFTTPPLDPLPDGPIVIEVVAIDPNGDPVSDTIGANIDTIAPVVIINELSDSASQTVVINGSVSGISAGDDVTITVTDSAGQVQTFVTQVDEQGNWSITTEALAEGLYTVLASAVDAAGNEGTDTENGLVDLTAPV
INIDPIGETNDTTPTISGNVSGVTVGSEITVVITAADGAIQTVIAIVADDGSWAIDVPVALVEGEFTVTATVLDAAGNEAQASTTGIIDVTAPIINITPIDDTQDTTQP
Molecular weight: 49.34 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Z5XPS4|Z5XPS4_9GAMM 50S ribosomal protein L34
MKRTFQPSVLKRKRTHGFRARMATANGRKVLARRRAKGRKVLSA
Molecular weight: 5.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,954 |
20 |
3,974 |
1,329,907 |
44 |
1,874 |
336.3 |
37.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.7 |
1.0 |
5.69 |
6.11 |
4.39 |
6.36 |
2.34 |
6.41 |
5.73 |
10.38 |
2.35 |
4.74 |
4.65 |
3.65 |
4.06 |
6.75 |
5.5 |
6.73 |
1.17 |
3.31 |
Note: For statistics only major isoforms were used (in this case 3,954 proteins)
For dipeptide frequency statistics click
here