Capsaspora owczarzaki (strain ATCC 30864)
Average proteome isoelectric point is 6.52
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 9,794 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0D2X2A2|A0A0D2X2A2_CAPO3 Uncharacterized protein
MTLPTPASSLSSAPLLPDHEPSLQASPSPRKSANPSANPSPLQQLLAAPDKLGLQSPPLPSPPSQVDMLSTSDMVVMANSSLDSTALATSEGDNHSLVAATAAGPTSPWLTPPQDSASSLLDSTSSNTDGNALSNPSQSSSNSSSSNNSSSSSHSNNGQNGSNPNGSITSSSSSSSSSNSSDSAAGSASS
SSNSSPPMEASASALSVLDGLLGVNPLAEPSISELSAALSADAAHLLPPIGEGPLNLSSLLADDSAPLDASALPLAAGDMLGALLTAPADEADPLASFLGTASTSVADDDAASLTTSSALLSAAATGLEANSANAGTDSLEDIMFSIMDETVGGPPSALDAAMLGVEGSLASSTADFLAAAAQYAAVTAA
SAPPPMFGGPCYDYYWALPTPV
Molecular weight: 39.29 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0D2W1D1|A0A0D2W1D1_CAPO3 Uncharacterized protein
MSASASNIPRTLNRISSTVSTILARVAANSSTASSQPFKLIPKLPSAPRTATARRGAWQPSPAQQAAQTKQQK
Molecular weight: 7.69 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8,738 |
1,056 |
9,794 |
5,440,371 |
37 |
12,732 |
622.6 |
67.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.87 |
1.37 |
5.41 |
5.05 |
3.52 |
5.91 |
2.53 |
3.94 |
3.69 |
9.37 |
2.03 |
3.51 |
4.75 |
5.83 |
5.73 |
9.52 |
6.27 |
6.62 |
0.97 |
2.1 |
Note: For statistics only major isoforms were used (in this case 8,738 proteins)
For dipeptide frequency statistics click
here