Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Average proteome isoelectric point is 6.7
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 23,598 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F7DB29|F7DB29_XENTR Uncharacterized protein (Fragment)
GEQEACSEGEQEACSEGEQGACSEGEQEACSEGEQEACSEGEQEMFEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEVEQEACSEVEQEACSEVEQEACSEGEQEACSEGEQEACSEGEQEACSEVEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACS
EGEQEACSEGEQEACSEVEQEACSEGEQEACSEGEQEACSEVEQEACSEGEQEACSEGEQEACSEGEQEACSEVEQEACSEGEQEACSEGEQEEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEGEQEACSEVEQEACSEGEQEACSEGEQEACSEGEQE
ACSEGEQEACSEGEQEACSEGEQEACSEGEQ
Molecular weight: 43.27 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F6VQB9|F6VQB9_XENTR Uncharacterized protein (Fragment)
PMLAPPLGGPNVRPQLAGHNVHPQLAGPNVRPQLAGPNARPPFGWLVPMLVPSWLVPMLAPPLAGPNVRPQLAGPNARPQLAGPNARPQLAGPNARPQLAGPNARPQLAGPNARPQLARPNARPQLAGPNARPQLAGPNARPQLAGPNARPQLAGPNARPQLAGPNSRPQLARPNSRPQLAGPNARPQLA
GPNARPQLARPNARPQLARPNARPQLARPNARPQLARPNAAHT
Molecular weight: 24.32 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
18,252 |
5,346 |
23,598 |
9,966,190 |
18 |
31,479 |
546.0 |
61.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.05 |
2.44 |
4.94 |
6.74 |
3.96 |
5.92 |
2.61 |
5.35 |
6.22 |
9.67 |
2.27 |
4.34 |
4.59 |
5.34 |
5.09 |
8.48 |
5.61 |
6.07 |
1.19 |
3.1 |
Note: For statistics only major isoforms were used (in this case 18,252 proteins)
For dipeptide frequency statistics click
here