Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus)
Average proteome isoelectric point is 6.82
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 76 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q00114|VG21_ICHVA Uncharacterized protein ORF21
MSATQGPLTEAANGCDDTGLGKTKNHWDGAVPRTTGEPRSLLGENRASSVLTTGLGPKPGPVWVDPRIRFHGVSESLPLTDTPWGPPPSPMDALGHGVMTPSGLKWCPPPPPKTESRSFLELLAMHQKAQADRDDTVTGETETTAREEDDVIFVEETNVNNPDVIEVIELKDVTETGHGTLKRRYPMRVR
RAPKRLVLDEQVVDDYPADSDDDTDAESDDAMSVLSDTCRTDDDASSVSSCGSFITDGSGSEESEDSASDETDDSDFDTDELTSESEEEESESESESESESESESE
Molecular weight: 32.0 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q00135|VG51_ICHVA Putative membrane protein ORF51
MAQYIVTIFSIIACTVYYAVSVVDFYLDPNLIAFIALSTHTISIIYSIILTAATSAITGVRRVIVQRATLNGANGPVAMNGPDPFWKLIYITNLILNSAGIVRVLILQRASVLHISFLYINSALGAGLLARLYLSTLRCLLPHKTYLQLSIWGV
Molecular weight: 16.87 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
76 |
0 |
76 |
33,924 |
82 |
1,556 |
446.4 |
49.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.46 |
1.82 |
5.64 |
5.77 |
4.02 |
7.12 |
2.27 |
5.54 |
4.35 |
9.11 |
2.8 |
3.44 |
2.41 |
6.14 |
6.62 |
6.37 |
7.62 |
7.5 |
1.2 |
2.79 |
Note: For statistics only major isoforms were used (in this case 76 proteins)
For dipeptide frequency statistics click
here