Ajellomyces capsulatus (strain H88) (Darlings disease fungus) (Histoplasma capsulatum)
Average proteome isoelectric point is 7.07
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 9,445 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F0U7K1|F0U7K1_AJEC8 Proteoglycan
MKVAFGSALLSAFALQRASATFNFPGFPGFPGFPGFPGFPGFPGFPGSPDPNYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPV
EPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVSPEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTDYPVSPEPTPTDYPVEPTPTDYPVEPTPTDYPVEPTPTD
YPVSPEPTPTDYPVEPTPTDYPVEPTPTDYPISPEPTPTDYPVTPEPTPTDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAP
TDATDYPVSPAPTDAYPVSTITAAPSYTTSTIYTTICETVTSCPPSVVSCPAGGYPVVVTRTVAIATTVCPVEAEATAPPQSTYTTSTVYTTTYETVTSCPPSVPSCPAGGYSTVITKTIPISTTVYLVETEPTTPPNPTLPNQGYDTAIPATPYTLSTAIYPTATVGSESPTYSGAAEPSARGSTAFIA
AFLLLSGLTQL
Molecular weight: 81.9 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F0UL68|F0UL68_AJEC8 Predicted protein
MSGPGAPSPGPRSASMGPGGGVPMSQQQQVNGGPPAAASPATSGPPSGVMSQQNLNQIVGKKPSLAVLSLRLARST
Molecular weight: 7.35 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
9,445 |
0 |
9,445 |
4,200,093 |
39 |
5,717 |
444.7 |
49.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.91 |
1.28 |
5.54 |
6.12 |
3.64 |
6.73 |
2.52 |
5.1 |
5.0 |
8.88 |
2.09 |
3.97 |
4.07 |
6.29 |
6.45 |
8.83 |
5.86 |
5.79 |
1.33 |
2.62 |
Note: For statistics only major isoforms were used (in this case 9,445 proteins)
For dipeptide frequency statistics click
here