Cellulomonas sp. Root930
Average proteome isoelectric point is 6.02
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,837 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q9CE47|A0A0Q9CE47_9CELL Uncharacterized protein
MEGSASSASLGEASDAPGGIAVATKPVVRRGLAFGAAGGALALGLLAGGVTGGLIAAAQASSDTDTAAASAVEGAAYEPPAAEVPSFVPPSWGSSPSTSDQEAASAASADQQVGVVTITSTLGYQNASSAGTGMVLTANGLVLTNNHVIEGSTSIEVTIESTGSSYVATVVGTDASSDVALLQLQDASGL
DTVALDDDSGAAVGDAVTAVGNAEGGGDLLAAVGSVTALDQTMTASTDGSSAETLSGLIEFSAAVVPGDSGGPVFDDEGEVIGMTTAASSSTVDTVAYAIDIEDALVIANQIQSGVASDTVTIGYPAFLGISLSTDGSVAGVLEGTPAASSGLVAGDVITAVDGVAVSSASSLSDLLGAYSPGDTVTLTW
TVASSGASASAPVTLIAGPAD
Molecular weight: 38.1 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q9CYJ5|A0A0Q9CYJ5_9CELL 50S ribosomal protein L34
MTKRTFQPNNRRRAKTHGFRLRMRTRAGRAILAARRRKGRAELSA
Molecular weight: 5.32 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,813 |
24 |
3,837 |
1,274,460 |
37 |
2,029 |
334.2 |
35.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.83 |
0.55 |
6.56 |
5.24 |
2.69 |
9.17 |
2.09 |
3.32 |
1.51 |
10.49 |
1.55 |
1.62 |
2.75 |
5.81 |
7.48 |
5.27 |
6.52 |
10.06 |
1.61 |
1.89 |
Note: For statistics only major isoforms were used (in this case 3,813 proteins)
For dipeptide frequency statistics click
here