Kandleria vitulina DSM 20405
Average proteome isoelectric point is 6.5
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,043 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0R2H4G7|A0A0R2H4G7_9FIRM Uncharacterized protein
MLSDSDLLIDSDSDFDLLSDSDLLVDSDSDLDLLVDSDSDLDLLSDSDLLVDSDSDLDLLSDSNLLVDSDSDLDLLSDSDLLVDSDSDLDLLSDSDLFVDSDSDLDLLSDSDLLVDSDFDLLIDSDSDFDLLSDSDLLVDSDSDLLSDSDLLVDSDSDLDLLSDSDLLVDSDSDLDLLSDSDLLVDSDSD
FDLLSDSDLLVDSDSDLLSDSDLLVDSDSDLDLLSDSDLLVDSDSDLDLLSDSDLLVDSDSDFDLLSDSDLLVDSDSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
IQILI
Molecular weight: 29.37 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0R2HDN4|A0A0R2HDN4_9FIRM 50S ribosomal protein L34
MNMKRTYQPNKRKRAKTHGFRARMATVGGRKVIARRRKKGRKVLSA
Molecular weight: 5.4 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,031 |
12 |
2,043 |
617,410 |
37 |
2,775 |
304.0 |
34.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.26 |
1.22 |
6.12 |
7.05 |
4.31 |
6.19 |
2.43 |
8.18 |
8.24 |
9.09 |
3.1 |
4.98 |
2.82 |
2.85 |
3.79 |
6.06 |
5.22 |
6.7 |
0.69 |
4.66 |
Note: For statistics only major isoforms were used (in this case 2,031 proteins)
For dipeptide frequency statistics click
here