Virtual 2D-PAGE plot for 8,610 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|F4P760|F4P760_BATDJ Putative uncharacterized protein
MVCFTQADSPFDDPEPEPDDPEFEPDDFDPEPDDFDPEPDSESNGPEFEPDDPEFEPDDPEFEPDDLEFEPDDFDPEPDSESNGPEFEPDDPEFEPDDPEFEPDDLELEPDDPEFEPDDFDPEPDSESNGPEFEPDDPEFEPDGPEFEPDDPEFEPDDFDSGPDDFDGLDSELDGLDFEPDDPEFEPDDF DGLDSELDGLDFELDSELDGPDFEPDDLDDPFLEDLVDSGPDELSLFEFEGLEDSGFDFDGSAMLDSVERDTSTELIERVLEGVGSLELFAFD
Molecular weight: 31.97 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|F4NUW0|F4NUW0_BATDJ Putative uncharacterized protein
MLRLAVSHMGRLSTRPIVEPTLIRALNRQFSSFTLLKPQGISRSPVVGSRSTTAMSRVSVSQSIAVRYATYGQEYNPSTLVRKRRFGFLKRLKTLGGRKILFRRMLKGRRRLTH
Molecular weight: 13.06 kDa Isoelectric point according different methods: