Parcubacteria bacterium DG_74_1
Average proteome isoelectric point is 7.73
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 548 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S7YDV5|A0A0S7YDV5_9BACT Uncharacterized protein (Fragment)
FEWAYAGTANPGDNIIGPAGGAWTTFGPTDSNGLAITSISSLSGDRIWVREVMQEGYIAFSGDTSTPRDNVSAEMYCHEDVLNYDNYDYIINPVLGETYYCVAFNAPEGGITTYNLTASTTGFGWITSDPAGINCGYEAFDCEEEYEEGTEVTLTATPGGGQKFDGWGGDCSGTSTVCVLTMDGAKSVTA
AFSLIPGVITYTVTFDGNGGTPTSTDVVVMEGESVDPLPTVTRDGYDFVEWNTASDGSGDTFTNSTPVIADITVYAIWQPTSVTYYTVTFIDGTTTYATRTVADGQSVGGAMPANPTKTGYTFVGWNTQSDGQGSVFTSGTVVTGDITVYAVWQEYVTPPVYGCTDPVAYNYNPDATADDGSCVYTRSGG
YAGPAGVVLGEEVEECGIYLYEYIQYGADNNPYEVRKLQAFLNLHMGSSLPITGIYDLATMDVLSQFQVRYKDEVLRPWVEDAGTHCDENEPTGYVYKTTKRWINLIMCPTLDIPMPDLSDYFPKADCSAYWQAVLGEEVTAAEDGVSDGAVADNATEENGTAEAEGPDELAPEDEEIIQLGDEVETENR
EREIPISWLILVVILVVAALIWFVLKGMKR
Molecular weight: 64.7 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S7YF01|A0A0S7YF01_9BACT 50S ribosomal protein L15 (Fragment)
MQLHEIKPIHKLKKSKRIGRGGKRGTYSGRGIKGQKSRAGRRFKPVIRE
Molecular weight: 5.63 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
547 |
1 |
548 |
160,473 |
49 |
1,280 |
293.4 |
33.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.37 |
0.93 |
4.23 |
7.91 |
5.21 |
6.86 |
1.27 |
8.94 |
9.36 |
10.54 |
1.73 |
3.77 |
3.16 |
4.17 |
4.9 |
5.61 |
4.68 |
6.03 |
1.16 |
3.17 |
Note: For statistics only major isoforms were used (in this case 547 proteins)
For dipeptide frequency statistics click
here