Marinobacter lipolyticus SM19
Average proteome isoelectric point is 5.96
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,627 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|R8B5N2|R8B5N2_9ALTE Cartilage oligomeric matrix protein
MRMTRFNWYMALLFTALLALAGCKSNGGGDSGAGVGGDSQVFDADGDGIPDNEDSCPDTVNSGVDQDADGIDDACDTDILASADIDGDGVLNGEDNCPAIANAGQENEDRDLKGDACDTDADGDSVADKEDDGSGGFTAIPVSEGGDNCPLTPNRNQADQDGDDIGNACDDDTDGDGVANDTDNCPLFAN
AGQVDSDGDGVGDACEADGDGDGIPDGSDNCPAVTNPDQEDLDGDGTGDACDDDIDGDGVSNDGGLLEPQDNCPLTPNPGQEDTDGDGIGDACDAVNDAEFACGTEGEDFTPMLASDTDISATASKDTSGCLLGLGLICDVESPANVVDDDLSNSATMRNTDLLGLSTITLKVATTTGFAYQEPNVVGVA
FAESAQALQADLLGGELIVRTTLNGVTQQESNGDGVFDLDLLGASGVLDGNEQSFLVFQTSERFDGVEVEFQPSLVSLLSEVNVFSVCSSKTEVSLP
Molecular weight: 48.52 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|R8B0C3|R8B0C3_9ALTE 50S ribosomal protein L34
MKRTFQPSVLKRKRVHGFRARMATANGRKVISRRRAKGRARLSA
Molecular weight: 5.11 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,610 |
17 |
3,627 |
1,213,386 |
23 |
3,930 |
336.1 |
37.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.57 |
0.95 |
5.98 |
6.61 |
3.79 |
7.88 |
2.25 |
5.27 |
3.6 |
10.56 |
2.6 |
3.32 |
3.95 |
4.7 |
6.47 |
5.99 |
5.21 |
7.31 |
1.37 |
2.63 |
Note: For statistics only major isoforms were used (in this case 3,610 proteins)
For dipeptide frequency statistics click
here