Thauera sp. 27
Average proteome isoelectric point is 6.65
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,271 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|N6XW62|N6XW62_9RHOO Putative outer membrane adhesin like protein (Fragment)
GTVTVEVPAGSYTDVAGNAGSGDSDSAAVDTLAPSVNVTINPDGTVSFVFSEAPVGFEASDIVVTNGSISNLVQDPTDPTRWTADLTPAAGFEGTVTVEVPAGSYTDVAGNAGSGDSDSTAVDTLAPSVNVTINPDGTVSFVFSEAPVGFEAADVVVTNGSISNLVQDPTDPTRWTADLTPAAGFEGTVT
VEVPAGSYTDVAGNAGSGDSDSTAVDTLAPSVNVTINPDGTVSFVFSEAPVGFEASDVVVTNGSISNLVQDPTDPTRWTADLTPAAGFEGTVTVEVPAGSYTDVAGNAGSGDSDSTAVDTLAPSVNVTINPDGTVSFVFSEPPVGFEASDVVVTNGSISNLVQDPTDPTHWTADLTPAAGFEGTVTVEVP
AGSYT
Molecular weight: 38.4 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|N6YEH5|N6YEH5_9RHOO Uncharacterized protein
MNGKHPAQAPHAPVVGAGRRSLQHRLGALRAGLKAALRALRSHPIKHPQR
Molecular weight: 5.39 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,231 |
40 |
4,271 |
1,396,327 |
24 |
11,953 |
330.0 |
35.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.04 |
0.96 |
5.54 |
5.86 |
3.52 |
8.41 |
2.3 |
4.58 |
2.79 |
10.95 |
2.36 |
2.49 |
3.46 |
4.98 |
7.6 |
5.09 |
4.83 |
7.65 |
1.4 |
2.18 |
Note: For statistics only major isoforms were used (in this case 4,231 proteins)
For dipeptide frequency statistics click
here