Virtual 2D-PAGE plot for 4,368 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0N0XHL4|A0A0N0XHL4_9NEIS Uncharacterized protein
MAIDPITAVDSSALVPIITPLPAATVQAANAAQVAATEADIATNVQATEGLNSGNLTATSVQQSVTTTTQFTLGNANAILDNNAANGLAATLANSPAAANLAGTVNVSTLTYNALGTPESVLVNVPADTAASLLNATATSSLLNAAQETANNINAAATDQTAANQATLDNNPNDINNPNNPASPLNVNNP ANPNSPLNINNPLNPASLNNPTNPLNPDSLNNPNNPLNPNSLNNPNNPANPLSLNNPNNPLNPDSVNNPNNPANPASVNNPTNPLNPANQLNQAQAVAANAAATANPTTAAVNATTAAQAANNNTSLLVNTQA
Molecular weight: 32.26 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0N0XG75|A0A0N0XG75_9NEIS Uncharacterized protein
MLFKPHRAKSFKASRTPVRRRLAAPAVQRQPLPALAWRKRAE
Molecular weight: 4.89 kDa Isoelectric point according different methods: