Parcubacteria group bacterium GW2011_GWA2_44_12
Average proteome isoelectric point is 7.4
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 813 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1GMS4|A0A0G1GMS4_9BACT Uncharacterized protein (Fragment)
NGDPNDIVISGNYAYIASTDNSEELQILDVSDPSAIQNAGKLTVVDLTALNSGNNNANAIAVAVSGNYLYMARAAGDPFLIFDLSNPANPGNPIGRTATVTGSPTDVQIAGNYAYLTSDDNNAEFQVVDISAKTLPTRVGFFDLNSGNGGADAQALILAGNYAIAGRVASAAPELYSINVTNPLLPGISS
TLEIGADARSISYDPSWVYAFLATNDNSNDFKVIDLSNPASLGSPPPFGQLNINNSPQQIVYEISLDRAFVASSNNIQELQVIKPQ
Molecular weight: 28.9 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1GJX8|A0A0G1GJX8_9BACT Uncharacterized protein
MTKSEPFLSGTDGALRAPRAQRSGEAGRKRGVGKMNARLALAFAAAKIRANTLARRHIILTNRLSKFHPTPFL
Molecular weight: 7.97 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
811 |
2 |
813 |
259,587 |
22 |
4,785 |
320.1 |
35.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.13 |
0.93 |
5.05 |
6.48 |
4.9 |
6.7 |
2.06 |
7.78 |
7.27 |
9.49 |
2.14 |
4.36 |
3.58 |
3.92 |
4.75 |
6.34 |
5.35 |
6.54 |
0.9 |
3.33 |
Note: For statistics only major isoforms were used (in this case 811 proteins)
For dipeptide frequency statistics click
here