Anguillid herpesvirus 1 (isolate Anguilla anguilla/Netherlands/500138/1998) (AngHV-1) (European eel herpesvirus)
Taxonomy: Viruses; dsDNA viruses, no RNA stage; Herpesvirales; Alloherpesviridae; Cyprinivirus; Anguillid herpesvirus 1
Average proteome isoelectric point is 6.33
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 129 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|D2E8A7|D2E8A7_ANHV1 Protein ORF56
MDAFVQATFEELPQLVDDRRGDRILLKRGIVLRIAPLDGTIHWGDDDIVSAWETLFLPTPEKMVVLGAIDHIDGEWICQVIVLVGEGGCVYFVDADELHYMAPSIAELDTNVSPTTPPIASYTYGQFCEASAEERDQHVLIPQATGDFVESHTEGMLADLERLNSV
MDAFVQATFEELPQLVDDRRGDRILLKRGIVLRIAPLDGTIHWGDDDIVSAWETLFLPTPEKMVVLGAIDHIDGEWICQVIVLVGEGGCVYFVDADELHYMAPSIAELDTNVSPTTPPIASYTYGQFCEASAEERDQHVLIPQATGDFVESHTEGMLADLERLNSV
Molecular weight: 18.39 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|D2E8B1|D2E8B1_ANHV1 Protein ORF60
MSTIAMLRSVARIAELTQGSDPNQSTNNNYRPDLSEEEKKDTIRDLQNEMLRARIEVLARARDKTAAQALDVEAGRKRTKKTKPARKIAATMTINDLPPIDKAKEMQKRLATKPVEPFSGKGHILKEVPKRRLEHEHAERKKLRSYEDLTRSMGMLMLTKPRRSASAWCLV
MSTIAMLRSVARIAELTQGSDPNQSTNNNYRPDLSEEEKKDTIRDLQNEMLRARIEVLARARDKTAAQALDVEAGRKRTKKTKPARKIAATMTINDLPPIDKAKEMQKRLATKPVEPFSGKGHILKEVPKRRLEHEHAERKKLRSYEDLTRSMGMLMLTKPRRSASAWCLV
Molecular weight: 19.52 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
70,829 |
105 |
3,392 |
553.4 |
61.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
8.05 |
1.97 |
5.78 |
6.15 |
3.68 |
5.79 |
2.33 |
4.14 |
4.95 |
8.87 |
2.5 |
3.8 |
3.66 |
6.59 |
5.83 |
6.8 |
7.38 |
7.21 |
1.74 |
2.77 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |