Virtual 2D-PAGE plot for 9,320 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A9GKR0|A9GKR0_SORC5 Uncharacterized protein
MRNMNLVSIGSMALILGATAFSAGCGDDTETTTGSGGGTTASSSAGEGGGGGTGGSGEGGSGEGGGGGTGGSEECVTCSAPLVADADPADLCESSIPKYQAVTQCICETCGAADGDPCYVACTTDEVADAACEACGTEAATTAEGACIEQGTACLLDGQ
Molecular weight: 14.89 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A9FRG4|A9FRG4_SORC5 Uncharacterized protein
MSHARPVWSRHRSAPGPGTRSRIHTRDASEQGPPATSTPVGWQGRLAGPPQPRSGWLAGPGPPQSRSGPPNLGRVRLNLGRVRLNLGRVRLNLGRVRLNLGRVRLSLGRGRLNLGRGRLNLGRVRLNLGRVRLNLGRVRLNLGRVHPARASAVAGGAAALTCAAGAPIPPHLQRTAARTGGSRRPPSPLD LSPELSDALARSIPLPPTEPWRKRS
Molecular weight: 23.02 kDa Isoelectric point according different methods: