Pediococcus damnosus LMG 28219
Average proteome isoelectric point is 7.05
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,996 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0F3FY65|A0A0F3FY65_9LACO Mucin
MPVVLPVPVVEPVPVVEPVPVVEPVPVVDPVPVVLPVPVVEPVPVVLPVPVVLPVPVVEPVPVVEPVPVVEPVPVVLPVPVVEPVPVVEPVPVVEPVPVVEPVPVVLPVPVVEPVPVVLPVPVVEPVPVVLPVPVVEPVPVVDPVPVVLPVPVVEPVPVVEPVPVVEPVPVVEPVPVVDPVPVVEPVLVV
GVEVPPPGVIVVPPGVFIVVPPGDVTVPFGVVFVPPGVIVEPPGVVTFPPGVFTVPPGVVIVPPGVVTSPPGVFVVPPGVVIVPPGVVTVPPGVVTSPPGVVVVPPGVVVVVVPPGVVVVVVPPGVFVVPPEVFVSLGVTAVTGSPAILSVLVLSFAP
Molecular weight: 34.8 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0F3FZ48|A0A0F3FZ48_9LACO 50S ribosomal protein L28
MAKDFVTGRRTHFGNTRSHALNHSRRSWKPNLHKVRILVDGKPKRVWVSARALKSGKIKRA
Molecular weight: 7.06 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,976 |
20 |
1,996 |
592,684 |
33 |
2,553 |
299.9 |
33.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.37 |
0.45 |
5.76 |
5.28 |
4.38 |
6.48 |
2.19 |
7.17 |
7.2 |
9.52 |
2.61 |
5.17 |
4.52 |
3.52 |
3.84 |
6.44 |
6.39 |
7.07 |
1.03 |
3.61 |
Note: For statistics only major isoforms were used (in this case 1,976 proteins)
For dipeptide frequency statistics click
here