Ranid herpesvirus 1 (strain McKinnell) (RaHV-1)
Taxonomy:
Average proteome isoelectric point is 7.12
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 132 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|Q9YQZ8|Q9YQZ8_RAHV1 ORF70
MESSLEMSSEDQENIAAGHEIQIIADAFVSNGYLSRTQAFMATCVGMLMASIGQEFEAAEPRDVDYMFDDRTDEAVDHMLHLFLDDAAHAYAKCELDEFLAGSAEEQERELAEEGSVIVEDYPLTDVTGFAVFTPSSDAPIVIVGVCKDTSWRHADIANLVHRVLMS
MESSLEMSSEDQENIAAGHEIQIIADAFVSNGYLSRTQAFMATCVGMLMASIGQEFEAAEPRDVDYMFDDRTDEAVDHMLHLFLDDAAHAYAKCELDEFLAGSAEEQERELAEEGSVIVEDYPLTDVTGFAVFTPSSDAPIVIVGVCKDTSWRHADIANLVHRVLMS
Molecular weight: 18.4 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|Q14VJ8|Q14VJ8_RAHV1 ORF132
MNEQEWETVRGHLEVSNEPCAIRGGDGLMGVYCDIAVSLRLAFAELHHDAALPHVLTTQWVHGELWRYAMEALQAAYIGLAPPSPPSAPWTRVSLAVFRASYTPPREHTLLLVTAACLAFVRLAERLTGGGQEADIHSLRVHTYSAHAAMHDPARRIGSMPRPLLTPMPRSLGRRPRCRPGLRAVRSWQL
HPALKEIALRHGALLVVSPIPVMRLALHYVDAFGRLATERARDLERERRRQRYPGGRPPGPHPTQRELNLSMRRRVWEWSHNHLEKDVDQATYQRLRADLIFDWQAAAAEGVAPPPMRTPVTQVVRNRGRS
MNEQEWETVRGHLEVSNEPCAIRGGDGLMGVYCDIAVSLRLAFAELHHDAALPHVLTTQWVHGELWRYAMEALQAAYIGLAPPSPPSAPWTRVSLAVFRASYTPPREHTLLLVTAACLAFVRLAERLTGGGQEADIHSLRVHTYSAHAAMHDPARRIGSMPRPLLTPMPRSLGRRPRCRPGLRAVRSWQL
HPALKEIALRHGALLVVSPIPVMRLALHYVDAFGRLATERARDLERERRRQRYPGGRPPGPHPTQRELNLSMRRRVWEWSHNHLEKDVDQATYQRLRADLIFDWQAAAAEGVAPPPMRTPVTQVVRNRGRS
Molecular weight: 36.24 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
0 |
59,898 |
110 |
3,149 |
453.8 |
50.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
10.02 |
3.26 |
4.28 |
5.16 |
2.87 |
5.75 |
3.65 |
3.71 |
2.84 |
9.58 |
2.52 |
3.25 |
3.78 |
6.62 |
7.43 |
6.61 |
6.84 |
6.92 |
1.36 |
3.52 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |