Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Average proteome isoelectric point is 6.38
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,949 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|G3XVX2|G3XVX2_ASPNA Uncharacterized protein
MVRFYRVSAATLVTAATVSAIPIPCLLPFLSGAGSLLGSSGLGASLGLGGSASGSGGADLGASLGGSGSGSGSAGAGLGADLGAGLSGSAGLGALLGGGASATGAAGAGASGAAGLGGSADLGADLGAGLGGSGSAGAGLGASATGAAGAGASGSAGLGAGLGGSAGLGGSAGLGGSAGLGAGLGGSATG
AAGAGASGAAGLGGSAGLGAGLGGSATGAAGAGASGAAGLGGSAGLGGSAGLGAGLGGSATGSLGAGASGAAGLGGSAGLGGSATGAAGAGASGAAGLGAGAGLGGSATGSLGAGASGAAGLGAGAGLGGSATGAAGAGASGAAGAGLGAGLSGSGSAGLSGSGSAGLGAGAGLGASPSGSVGASPSAGA
GLGAGLSGSGSAGLSGSGSAGLGAGAGLGGSGSASGDVSGSGSGSADLGAGASGSGDDDTDVGVSPTTAEAPSATTTWVSASTSVSLGPYGGASGSITAGGSTGGDDSDDSGAGADADADADASADADASADADADASASGSGSADANASAGASVSGSAEASASANAKASASLNFSA
Molecular weight: 44.4 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G3Y4P2|G3Y4P2_ASPNA Ribosomal protein RPL39
MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKSRLGV
Molecular weight: 6.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,943 |
6 |
10,949 |
5,328,393 |
42 |
6,284 |
486.9 |
53.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.48 |
1.29 |
5.6 |
6.08 |
3.78 |
6.86 |
2.43 |
5.03 |
4.42 |
9.23 |
2.19 |
3.6 |
3.99 |
5.95 |
6.06 |
8.21 |
6.0 |
6.31 |
1.53 |
2.97 |
Note: For statistics only major isoforms were used (in this case 10,943 proteins)
For dipeptide frequency statistics click
here