Virtual 2D-PAGE plot for 3,523 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|K0IP10|K0IP10_NITGG Putative hemolysin-type calcium-binding region
MALLLAVPSTTAMVLAATTVYGTSASDTLYDTAEGDTIYGYGGDDTIYANQGNDIVYGGSGNDQITEGPGGDSRIYGGSGDDEIVTGYGYDVVYGNSGNDKIHDIGSALIYGGAGNDNLDGSKYADTIYGGSDDDWINGRLGDDRLNGGAGNDEIIGWDGNDILRGSGGNDILTGDGPDSNTGADRFYCG DGIDTITDYNPAEGDWKSSDCENY
Molecular weight: 22.13 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|K0IMQ8|K0IMQ8_NITGG Uncharacterized protein
MLLVRILHLLINLQIILLQAVLKNNQQITVHLLVIQRTITIPRLRMVKNRNHRMPLHHLKVSTIILLTRQPRMNNHQKLQVISHHLEMLMLHQAMLLLQPHLLTVQISKVSSNHQLRM
Molecular weight: 13.97 kDa Isoelectric point according different methods: